PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g067410.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 264aa    MW: 30203.5 Da    PI: 5.6571
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g067410.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.4e-1865118356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa+ k
  Sopim02g067410.0.1  65 KKRRLNMEQVKALERSFEIGNKLEPERKMQLARALGLKPRQIAIWFQNRRARCK 118
                         456899**********************************************99 PP

2HD-ZIP_I/II129.51.4e-4164155192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lgl+prq+a+WFqnrRAR ktkqlEkdye Lkr++d+lk++n++L++++++L++el
  Sopim02g067410.0.1  64 EKKRRLNMEQVKALERSFEIGNKLEPERKMQLARALGLKPRQIAIWFQNRRARCKTKQLEKDYEILKRQCDKLKSDNDALKTQNKNLHSEL 154
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Sopim02g067410.0.1 155 Q 155
                         7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-1961122IPR009057Homeodomain-like
SMARTSM003891.9E-1863124IPR001356Homeobox domain
PROSITE profilePS5007116.16364120IPR001356Homeobox domain
PfamPF000464.3E-1565118IPR001356Homeobox domain
CDDcd000861.66E-1565121No hitNo description
Gene3DG3DSA:1.10.10.606.5E-1967127IPR009057Homeodomain-like
PRINTSPR000311.1E-591100IPR000047Helix-turn-helix motif
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5100116IPR000047Helix-turn-helix motif
PfamPF021836.4E-15120158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGFVPGAPED NELPPPFPSV YPHQEFQGIS SVLMRRAMSF DHQDSRADDI DMSDDDGSSQ  60
LLGEKKRRLN MEQVKALERS FEIGNKLEPE RKMQLARALG LKPRQIAIWF QNRRARCKTK  120
QLEKDYEILK RQCDKLKSDN DALKTQNKNL HSELQLLSLR NRESTGGGTP ILFNLNKENE  180
GSNWNNGSGD ENSTIIDVNL GRTSSTNSPH NNNNNDHVFQ TPNFKIEEQT QSHDVPEEGF  240
CNIFTNVEDQ TNYWPLPVQQ HFY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARCKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233356.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like
SwissprotQ004661e-59HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLK4B7730.0K4B773_SOLLC; Uncharacterized protein
STRINGSolyc02g067410.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-50homeobox 3